Manage your own movie collection and always keep it with you with our Apps. Price track movies and get price drop notifications instantly. Become a member to take full advantage of all site features.

Best Blu-ray Deals

Best Blu-ray Deals, See All the Deals »
Top deals | Price drops  
 All countries United States United Kingdom Canada Germany France Spain Italy Japan
Prisoners (Blu-ray)
The Vincent Price Collection (Blu-ray)
In the Mouth of Madness (Blu-ray)
Sherlock Holmes: The Complete Series (Blu-ray)
Saw: The Complete Movie Collection (Blu-ray)
The Amazing Spider-Man 2 (Blu-ray)
Leprechaun: The Complete Movie Collection (Blu-ray)
V/H/S/2 (Blu-ray)
The Haunting (Blu-ray)
Sleeping Beauty (Blu-ray)
V/H/S/2 (Blu-ray)
The Amityville Horror Trilogy (Blu-ray)
Game of Thrones: The Complete Fourth Season (Blu-ray)
Between the Buried and Me: Future Sequence - Live at the Fidelitorium (Blu-ray)
Maleficent (Blu-ray)
Hell of the Living Dead / Rats: Night of Terror (Blu-ray)
The Final Terror (Blu-ray)
Fast & Furious 6-Movie Collection (Blu-ray)
The Wicker Man (Blu-ray)

Go Back   Blu-ray Forum > Movies > Blu-ray Movies - North America

Thread Tools Display Modes
Old 01-03-2013, 01:56 AM   #21
remake remake is offline
Aug 2011

Originally Posted by SwaggerJagger View Post
I'll Always Always Know What You Did Last Summer. Like, Always.
  Reply With Quote
Old 01-03-2013, 03:22 AM   #22
drmb1990 drmb1990 is offline
Active Member
drmb1990's Avatar
Oct 2011

I can't wait for the sequel.... "I Never Knew You Did That Last Summer" tbh
  Reply With Quote
Old 01-03-2013, 08:08 AM   #23
SwaggerJagger SwaggerJagger is online now
Blu-ray Samurai
SwaggerJagger's Avatar
Jul 2011

Originally Posted by drmb1990 View Post
I can't wait for the sequel.... "I Never Knew You Did That Last Summer" tbh
I forgot what i did last summer.
Anna Faris' Biggest Fan

A year ago (June 2013), I saw Showgirls for the first time and it's changed my life.
  Reply With Quote
Old 01-03-2013, 09:04 AM   #24
drmb1990 drmb1990 is offline
Active Member
drmb1990's Avatar
Oct 2011

Originally Posted by SwaggerJagger View Post
I forgot what i did last summer.
I Screwed Up Last Summer
  Reply With Quote
Old 01-03-2013, 12:20 PM   #25
grrrarg grrrarg is offline
Power Member
grrrarg's Avatar
May 2008

My favorite film in the series has always been:

I'll Never Remember What He Said You Knew She Might Have Possibly Heard He Did That You Know They Could Have Perhaps Known About What Perchance Happened When We Watched I Know What You Did Last Summer Last Summer

It was pretty self aware and trendy, particularly when the main plot point was about watching the original movie "Last Summer."

You can also abbreviate it to INRWHSYKSMHPHHDTYKTCHPKAWPHWWWIKWYDLSLS for the sake of brevity.

  Reply With Quote
Old 01-03-2013, 01:24 PM   #26
drmb1990 drmb1990 is offline
Active Member
drmb1990's Avatar
Oct 2011

Originally Posted by grrrarg View Post
My favorite film in the series has always been:

I'll Never Remember What He Said You Knew She Might Have Possibly Heard He Did That You Know They Could Have Perhaps Known About What Perchance Happened When We Watched I Know What You Did Last Summer Last Summer

It was pretty self aware and trendy, particularly when the main plot point was about watching the original movie "Last Summer."

You can also abbreviate it to INRWHSYKSMHPHHDTYKTCHPKAWPHWWWIKWYDLSLS for the sake of brevity.

It should have won the oscar for best picture and the mtv award for best kiss for Jennifer Love Hewitt and Sean Connery making out with the severed head of Sarah Michelle Gellar.

on a side note, did anyone know this movie is based off a book? It was actually a decent book at that
  Reply With Quote
Old 01-03-2013, 02:51 PM   #27
sukraj sukraj is offline
Blu-ray Knight
sukraj's Avatar
Jul 2011

love this film.
  Reply With Quote
Old 01-03-2013, 04:26 PM   #28
sancho sancho is offline
Power Member
sancho's Avatar
Aug 2010

  Reply With Quote
Go Back   Blu-ray Forum > Movies > Blu-ray Movies - North America

Similar Threads
thread Forum Thread Starter Replies Last Post
What Summer Hits Are You Waiting For Blu-ray For? Movies obriensg1 29 05-18-2009 08:29 PM
Jack Johnson Blu Ray Out This Summer Blu-ray Movies - North America Cup Overflowing 0 04-22-2009 02:30 PM
I What You Did Last Summer Films Coming to Blu Ray Blu-ray Movies - North America miked924 40 05-20-2008 07:17 AM
7 out of the 10 biggest films this summer will be on Blu-ray Blu-ray Movies - North America techyted 5 09-04-2007 12:57 AM
Light summer for Blu-ray?? Blu-ray Movies - North America atdm71 31 06-12-2007 06:46 AM

Thread Tools
Display Modes

Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts

BB code is On
Smilies are On
[IMG] code is On
HTML code is Off

Forum Jump

All times are GMT. The time now is 04:18 PM.